Hasil Pencarian  ::  Simpan CSV :: Kembali

Hasil Pencarian

Ditemukan 16 dokumen yang sesuai dengan query
cover
Feni Fitriani Taufik
"ABSTRAK Latar belakang :Pendidikan dokter spesialis merupakan pendidikan orang dewasa adult learner untuk mencapai kompetensi klinis yang diharapkan Lingkungan pendidikan merupakan salah satu aktor yang perlu dipertimbangkan dalam pengembangan kurikulum dan proses pendidikan Lingkungan pendidikan dapat diartikan sebagai segala sesuatu yang dirasakan oleh peserta didik yang dapat mempengaruhi proses pendidikan. Perlu lingkungan pendidikan yang mendukung untuk meningkatkan kualitas proses pembelajaran peserta didik. Penelitian ini bertujuan mengetahui persepsi peserta didik, pengelola program dan staf pengajar terhadap lingkungan pendidikan pada Program Pendidikan DokterSpesialis PPDS Paru, FKUI. Metode :Jenis penelitian yang digunakan adalah mixed methods dengan setting sequential explanatory design. Tahap pertama dilakukan penelitian kuantitatif dengan menggunakan kuesioner Postgraduate Hospital Educational Enviroment Measure PHEEM yang diisi oleh peserta PPDS Paru pada bulan Maret-Juni 2014.Hasil PHEEM ini dielaborasi lebih lanjut melalui penelitian kualitatif berupa Focus Group Discussion pada peserta PPDS Paru dan wawancara mendalam dengan pengelola program dan staf pengajar di Departemen Pulmonologi dan Kedokteran Respirasi, FKUI.Hasil :Sebanyak 87 89,7 peserta PPDS Paru periode Maret-Juni 2014 telah mengisi kuesioner PHEEM dan didapatkan sebanyak 74,7 peserta menilai lingkungan pendidikan lebih banyak positif dari pada negative dan memerlukan perbaikan 100,85; rentang nilai 81-120 . Peran otonomi dinilai positif oleh 79,3 peserta 36,93; rentang nilai 29-42 , pengajaran dianggap sudah bergerak kearah yang benar oleh 62,1 peserta 36,56; rentang nilai 31-45 dan 70,1 berpendapat bahwa dukungan social lebih banyak pro dari pada kontra 27,36; rentang nilai 23-33 .Pada penelitian kualitatif diperoleh hasil bahwa peran otonomi yang perlu diperbaiki adalah tersedianya panduan pengajaran dan protokol klinis yang informatif, diperlukan perbaikan system supervise dan pemberian umpan balik pada peran pengajaran, dan perbaikan budaya menyalahkan dan meningkatkan peran penasehat akademik dalam bimbingan dan konseling pada dukungan sosial. Kesimpulan :Lingkungan pendidikan pada PPDS Paru dinilai cukup baik dan kondusif. Perbaikan yang diperlukan untuk menjadikan lingkungan pendidikan lebih optimal adalah pembuatan Buku Rancangan Pengajaran yang informatif, optimalisasi logbook sebagai salah satu instrument evaluasi, peningkatan supervise oleh staf pengajar, keterampilan pemberian umpan balik dan peran pembimbing akademik dalam evaluasi peserta PPDS. Kata kunci :Lingkunganpendidikan, PHEEM, Mixed methods

ABSTRACT
Background Educational environment is one of the most important factor should be considered in curriculum development. Educational environment is the condition that may affect education process in student. Specialty in medicine is adult learning process to gain define clinical competence. Process ofeducationcan be accelerated with proper educational environment. This study aims to Perception of resident, clinical teacher and study program manager to educational environment in Pulmonology dan Respiratory Medicine Residency Program, Faculty of MedicineUniversitasIndonesia. Methods This study using mixed methods with sequential explanatory design.Preliminary of this study is a quantitative study using Postgraduate Hospital Educational Environment Measure PHEEM questionnaire to Pulmonology residentsonMarch until June 2014. The results of the questionnaire will be elaborated with qualitative study based on Focus Group Discussionamong Pulmonology residents and deep interview to the study program manager and clinical teachers at the Department of Pulmonology and Respiratory Medicine FMUI. Result Eighty seven 89,7 pulmonology residents on March until June 2014 had filled in PHEEM questionnaire resulting in mean of perception of the educational environment total PHEEM mostly 74,7 positive and need to be improved score 100,85 81 120 . Positive perception of the autonomy role is 79,3 score 36,93 29 42 , perception that the teaching role performed in the correct way62,1 score 36,56 31 45 and 70,1 of perception stated pro to social support rather than cons score 27,36 22 33 . The qualitative study resulting an autonomy role which is need to be improved availability of teaching guideline and informative clinical protocols. Based on several aspect of teaching role, we need toimproved the supervision system and feedback giving. The blamming culture, supervision and counseling are the factors that need toimproved on social supporting role. ConclusionEducational environment in Pulmonology and Respiratory Medicine Residency Program is positive and condusive. Theimprovement need of the informative ldquo BukuRancanganPengajaran rdquo and optimalizationof logbook as one of the evaluation instrument.Role of staffs in supervising resident skills, feedback and the role of the academic mentor in evaluating residents still need improvement foroptimalization educational environment that may lead to support the adult learning process in students.
"
Depok: Fakultas Kedokteran Universitas Indonesia, 2018
T-Pdf
UI - Tesis Membership  Universitas Indonesia Library
cover
Pornrat Sadangharn
"ABSTRAK
This research aims at studying an elderly employment model for the Thai automotive industry. Mixed methods with a sequential exploratory strategy were utilized. Grounded theory was employed by using in-depth interviews to investigate the characteristics of elderly employment in the Thai automotive industry. For this stage of the research, theoretical and purposive sampling was used to select 32 key informants from four groups of stakeholders: (1) elderly workers, (2) employers or human resource managers, (3) government officers, and (4) academics. The findings were then validated using a quantitative approach with structural equation modelling (SEM). A total of 308 elderly workers and human resource managers were surveyed regarding their opinion about elderly employment. Based on the survey, the elderly employment model in the Thai automotive industry, which is comprised of the approach to elderly employment, elderly employment preparation, and key success factors for elderly employment, was revealed to be a good fit. "
Depok: FEUI, 2017
330 UI-SEAM 11:2 (2017)
Artikel Jurnal  Universitas Indonesia Library
cover
Ardi Irvan
"ABSTRAK
E-procurement merupakan bentuk inovasi teknologi dalam dunia bisnis yang memungkinkan operasional bisnis yang efisien dan transparan melalui keterbukaan informasi. PT Serasi Autoraya (SERA) berupaya mengimplementasikan e-procurement dalam proses bisnisnya untuk menggantikan sistem konvensional yang tidak efisien dan rentan dari sisi keamanan dan pengawasan. Guna memastikan kesiapan organisasi dan kontrol terhadap proses, manajemen SERA menginginkan evaluasi kesiapan implementasi e-procurement yang akan mereka lakukan.
Penelitian yang dilakukan menggunakan metode campuran yang menggabungkan data kuantitatif dan kualitatif. Wawancara, studi dokumen, dan validasi pakar digunakan untuk mengumpulkan data dari empat narasumber yang merupakan pemangku kepentingan proyek implementasi e-procurement SERA. Perancangan model pengukuran dan analisis data menggunakan metode Analytical Hierarchy Process (AHP) dengan alat bantu Expert Choice 11.
Dari hasil analisis data diketahui dari perspektif indikator, indikator keamanan dan autentikasi menjadi indikator dengan pengaruh paling signifikan terhadap kesuksesan implementasi e-procurement. Dari perspektif kategori, organisasi menjadi yang paling dominan memengaruhi keberhasilan implementasi e-procurement. Hasil evaluasi menunjukkan tingkat kesiapan perusahaan untuk mengimplementasikan e-procurement masih rendah. Sebagian besar aspek penilaian saat ini statusnya masih berupa gambaran umum yang belum dibakukan dan dilaksanakan.

ABSTRACT
E-procurement is an innovation in the business that enables efficient and transparent business operations through information disclosure. PT Serasi Autoraya (SERA) requested the implementation of e-procurement in its business processes for the implementation of conventional systems that are inefficient and vulnerable to security and supervision. To ensure organizational readiness and control of the process, SERA management requests an evaluation of the readiness for the implementation of e-procurement that they will undertake.
Research conducted using mixed method that collects quantitative and qualitative data. Interviews, document studies, and expert validation are used to collect data from four stakeholders of the SERA e-procurement implementation project. Designing models for measurement and analysis of data using the Analytical Hierarchy Process (AHP) method with the Expert Choice 11.
The results show that from indicator perspective, the security and authentication indicators are the most significant influence on the success of e-procurement implementation. Whereas from a category perspective, organization is the most dominant influencing the success of implementation. Evaluation of readiness shows the level of readiness of the company to implement e-procurement is low. The company has not a clear and specific plan for most of indicators.
"
Depok: Fakultas Ilmu Komputer Universitas Indonesia, 2019
TA-Pdf
UI - Tugas Akhir  Universitas Indonesia Library
cover
Nurhafizatun Nisa
"Sumber daya manusia (SDM) telah menjadi sumber daya yang penting dalam perkembangan perekonomian perusahaan. Sebagai elemen penting, SDM memiliki sistem sendiri yang menunjang pekerjaan yang digunakan di perusahaan, yaitu SISDM. Untuk mengetahui efisiensi dan efektivitas SISDM, maka diperlukan evaluasi. Penelitian ini mengidentifikasi dimensi pengukuran kualitas SISDM dan pengaruhnya terhadap efisiensi dan efektivitas penggunaan SISDM di perusahaan. Model penelitian ini menggunakan framework HOT-Fit Model dengan menerapkan mixed methods, yaitu penelitian kualitatif dengan thematic analysis dan penelitian kuantitatif dengan analisis kuantitatif PLS-SEM. Pada penelitian kualitatif, model penelitian yang dikembangkan terdiri dari 9 variabel penelitian yang diperoleh berdasarkan hasil wawancara dengan narasumber dari PT XYZ dan studi literatur. Pada penelitian ini, sebanyak 13 hipotesis diajukan yang dianalisis menggunakan SmartPLS. Setelah kuesioner dibagikan, terkumpul data bersih sejumlah 41 data. Hasil dari analisis menunjukkan terdapat beberapa hipotesis yang diterima dan ditolak. System quality berpengaruh positif terhadap system use dan user satisfaction. Namun, information quality tidak berpengaruh positif terhadap system use dan user satisfaction. Lebih lanjut, service quality terbukti berhubungan positif dengan user satisfaction, sedangkan service quality terhadap system use tidak berhubungan positif. Hipotesis akhir, ditemukan bahwa system use tidak memiliki pengaruh yang signifikan terhadap HRIS Management Net Benefits, sedangkan user satisfaction memiliki hubungan yang positif yang signifikan terhadap HRIS Management Net Benefits. Penelitian ini diharapkan dapat menjadi acuan dalam mengevaluasi SISDM bagi perusahaan yang menggunakannya.

Human resources (HR) have become an important resource in the development of the company's economy. As an important element, HR has its own system that supports the work used in the company, namely HRIS. To determine the efficiency and effectiveness of HRIS, an evaluation is needed. This study identified the dimensions of HRIS quality measurement and their influence on the efficiency and effectiveness of using HRIS in companies. This research model uses the HOT-Fit Model framework by applying mixed methods, namely qualitative research with thematic analysis and quantitative research with PLS-SEM quantitative analysis. In qualitative research, the research model developed consists of 9 research variables obtained based on the results of interviews with informants from PT XYZ and literature studies. In this study, 13 hypotheses were proposed which were analyzed using SmartPLS. After the questionnaires were distributed, 41 data were collected. The results of the analysis show that there are several hypotheses that are accepted and rejected. System quality has a positive effect on system use and user satisfaction. However, information quality has no positive effect on system use and user satisfaction. Furthermore, service quality is proven to be positively related to user satisfaction, while service quality to system use is not positively related. The final hypothesis is that system use does not have a significant effect on HRIS Management Net Benefits, while user satisfaction has a significant positive relationship with HRIS Management Net Benefits. This research is expected to be a reference in evaluating HRIS for companies that use it."
Depok: Fakultas Ilmu Komputer Universitas Indonesia, 2023
S-pdf
UI - Skripsi Membership  Universitas Indonesia Library
cover
Adhiba Mastura
"Peningkatan penggunaan e-Commerce selama pandemi COVID-19 di Indonesia menyebabkan penggunaan jasa ekspedisi sebagai penyedia layanan pengiriman barang e-Commerce juga meningkat. Salah satu platform yang digunakan penjual e-Commerce untuk mengirim barang adalah Wehelpyou. Memahami permasalahan yang biasanya dialami pengguna saat mengirim barang menggunakan aplikasi Wehelpyou dari sisi user interface/user experience melalui pendekatan kualitatif dan kuantitatif dengan metode penelitian mixed methods research design diharapkan dapat meningkatkan kualitas serta jasa yang diberikan Wehelpyou. Pendekatan kualitatif menggunakan data kuesioner daring yang memiliki open-ended questions serta data yang diperoleh dari usability testing dan pendekatan kuantitatif penelitian ini menggunakan data kuesioner daring yang memiliki close-ended questions dan system usability scale. Setelah data tersebut dikumpulkan, data dianalisis kemudian penulis memperbaiki desain aplikasi saat ini dengan merancang desain antarmuka alternatif yang disesuaikan dengan prinsip desain interaksi. Secara keseluruhan, hasil evaluasi yang didapatkan dari desain antarmuka alternatif bersifat positif karena penulis mendapatkan nilai SUS 84,75 dan semua responden UT dapat menyelesaikan skenario yang sudah disusun. Hal ini menunjukkan pengguna cukup puas dan mendapatkan kesan yang baik dari hasil rancangan desain antarmuka alternatif fitur delivery aplikasi Wehelpyou.

Since the beginning of March 2020, the COVID-19 pandemic forced most activities in Indonesia to be conducted online. As a result, demand for delivery services grew exponentially as individuals were obliged to stay inside for their safety by the government. One of the delivery service platforms that capitalized on the influx of demand is known as Wehelpyou. The purpose of this research is to find out the user’s problems related to interface/user experience that usually occur when a user is using Wehelpyou’s mobile application through qualitative and quantitative approaches using mixed methods research design. The research is done so that the problems can be fixed, and customers can use the application easily, also feel satisfied with the service given by Wehelpyou through its mobile application. The qualitative approach uses the data gathered from open-ended questions in the online questionnaire and usability testing results. On the other hand, the quantitative approach uses data from close-ended questions in the online questionnaire and system usability scale results. The usability evaluation of the application's alternative design result shows that participants are quite satisfied and give positive feedbacks towards the design because the SUS score achieved is 84.75 and all the UT participants can complete the scenarios given."
Depok: Fakultas Ilmu Komputer Universitas Indonesia, 2021
S-pdf
UI - Skripsi Membership  Universitas Indonesia Library
cover
Detricia Tedjawidjaja
"Tahap perkembangan remaja seringkali ditandai dengan peningkatan kecemasan sosial. Meskipun Social Anxiety Disorder (SAD) merupakan gangguan yang umum terjadi pada remaja, SAD cenderung sulit untuk diidentifikasi. Faktor budaya diduga berpengaruh terhadap batasan antara tingkat kecemasan sosial yang normal dan patologis. Penelitian ini menggunakan explanatory sequential design (kuantitatif-kualitatif) untuk (1) menguji pengaruh self-construal terhadap kecemasan sosial melalui peran mediasi emosi malu pada remaja etnis Jawa dan (2) menjelaskan penghayatan kecemasan sosial remaja etnis Jawa yang dibandingkan dengan gejala SAD dalam DSM-5. Dalam penelitian kuantitatif, pengukuran terhadap kecemasan sosial, self-construal, dan emosi malu melibatkan 37 remaja berusia 14-17 tahun dengan kedua orang tua beretnis Jawa dan berdomisili di Provinsi DI Yogyakarta, Jawa Tengah, dan Jawa Timur. Hasil uji mediasi menggunakan causal steps approach menunjukkan bahwa emosi malu tidak berperan dalam hubungan antara self-construal dengan kecemasan sosial. Selain itu, independent construal secara signifikan berpengaruh negatif dan emosi malu berpengaruh positif terhadap tingkat kecemasan sosial. Selanjutnya, empat partisipan dengan kecemasan sosial yang tinggi berdasarkan pengukuran pada penelitian kuantitatif diikutsertakan dalam wawancara mendalam tentang gejala kecemasan sosial yang mereka alami. Hasil dari inductive analysis menunjukkan bahwa tingginya kecemasan sosial tidak selalu mengarah pada penegakan diagnosis SAD. Norma dalam budaya Jawa yang cenderung menerima gejala kecemasan sosial menyebabkan dampak negatif tidak muncul terhadap fungsi sehari-hari remaja. Implikasi dari hasil penelitian ini menekankan pada pentingnya mempertimbangkan konteks budaya remaja dalam menegakkan diagnosis SAD.

Adolescence is often marked by increased social anxiety. Even though Social Anxiety Disorder (SAD) is one of the most common disorders among adolescents, SAD is likely to be difficult to recognize. Cultural factors may influence the boundary between the normal and pathological level of social anxiety to be ambiguous. Using an explanatory sequential design (quantitative-qualitative), the aims of this study were to (1) examine whether self-construal influence social anxiety through mediating role of and (2) explore the meaning and experience of social anxiety symptoms among Javanese adolescents by comparing them with SAD symptoms in DSM-5. For quantitative study, measurement of social anxiety, self-construal, and shame involved 37 adolescents aged 14-17 year-old with both parents are Javanese and settle in DI Yogyakarta, Central Java, and East Java Province. The result of mediation analysis using causal steps approach indicated that there is no mediation effect of shame in the relationship between self-construal and social anxiety. In addition, only independent construal have a negative effect and shame have a positive effect significantly on social anxiety intensity. Furthermore, four participants with high social anxiety based on measurement in the quantitative study were joined an in-depth interview about their social anxiety symptoms. Results of the inductive analysis indicated that high social anxiety does not necessarily lead to the diagnosis of SAD. Norms in Javanese culture that tends to tolerate social anxiety symptoms causes no negative impact on adolescents' functions of daily life. The findings suggest that considering adolescent cultural context is essential for diagnosing SAD."
Depok: Fakultas Psikologi Universitas Indonesia, 2021
T-Pdf
UI - Tesis Membership  Universitas Indonesia Library
cover
Lucky Windaningtyas Marmer
"ABSTRAK
Penelitian ini bertujuan untuk menemukan peran distres psikologis dan stigma keluarga terhadap sikap caregiver anggota keluarga penyandang skizofrenia dalam mencari bantuan profesional dan mendapatkan gambaran lebih mendalam mengenai pengalaman caregiver terkait sikap pencarian bantuan profesional. Metode yang digunakan dalam penelitian adalah pendekatan penelitian metode campuran (mixed-methods research) dengan model sequential explanatory strategy. Terdapat 65 partisipan yang mengikuti penelitian kuantitatif dan selanjutnya tiga dari 65 partisipan diwawancarai secara kualitatif. Peneliti menggunakan alat ukur GHQ-12 (General Health Questionnaire-12), FSS (Family Stigma Scale), dan Skala Pencarian Bantuan Profesional, kemudian wawancara semi terstruktur. Pengolahan data secara kuantitatif dilakukan dengan analisis regresi berganda dan secara kualitatif menggunakan analisis tematik. Hasil dari penelitian menunjukkan bahwa distres psikologis dan stigma keluarga tidak dapat memprediksi secara signifikan sikap mencari bantuan profesional F(2, 62) = 2.733, p = 0.073; ∆R2 = 0.051. Adanya faktor lain, seperti literasi kesehatan mental, dukungan sosial, strategi koping, dan upaya dini pertolongan dinilai berhubungan dengan sikap perilaku mencari bantuan profesional. Melalui penelitian ini diharapkan tenaga profesional dapat melakukan pendampingan secara kontinyu pada kelompok caregiver yang paling berisiko. Mempertimbangkan untuk memberikan intervensi pada kelompok caregiver orang dengan skizofrenia episode psikotik pertama untuk mengurangi distres psikologis. Selain itu, psikoedukasi dapat diberikan ke masyarakat terkait dengan gangguan kesehatan mental dan manfaat bantuan profesional untuk mengurangi stigma.

ABSTRACT
This study aims to examine the role of psychological distress and family stigma on attitudes towards help-seeking behaviour among caregiver family member of patient with schizophrenia also explore caregiver experiences related to attitudes seeking professional help. The method used in this research was a mixed-methods research approach with a sequential explanatory strategy model. There were 65 participants who participated in the study and then three of 65 participants were interviewed further. Researcher used GHQ-12 (General Health Questionnaire-12), FSS (Family Stigma Scale), and Attitudes towards Help-seeking, then semi-structured interviews for qualitative data collection. The results of the study showed that psychological distress and family stigma did not significantly predict the attitudes towards help-seeking behaviour F(2, 62) = 2.733, p = 0.073; ∆R2 = 0.051. Based on qualitative results, factors such as mental health literacy, social support, oping strategy, and sequence of help-seeking were assumed have relation to attitudes towards help-seeking behaviour. It is important to professional provide continuous assistance to risky caregiver groups. Intervention to caregiver family member of patients with schizophrenia may be considered as a treatment to prevent psychological distress. Besides that, psychoeducation can be given to the community related to mental health disorders and the benefits of professional help to reduce stigma."
Depok: Fakultas Psikologi Universitas Indonesia, 2020
T-pdf
UI - Tesis Membership  Universitas Indonesia Library
cover
Rohmayani
"ABSTRAK
Kementerian Hukum dan Hak Asasi Manusia (Kemenkumham) mempunyai tugas dan fungsi di bidang hak asasi manusia, peraturan perundang-undangan, administrasi hukum umum, hak kekayaan intelektual, pemasyarakatan, dan keimigrasian. Laporan kinerja instansi pemerintah (LAKIP) Kemenkumham tahun 2017 menyebutkan bahwa 2 (dua) indikator kinerja utama (IKU) Kemenkumham, yaitu indeks integritas memiliki target nilai 3.3 dan indeks reformasi birokrasi memiliki target nilai 85. Hasil evaluasi pelaksanaan reformasi birokrasi Kemenkumham tahun 2017 menyebutkan bahwa nilai indeks integritas adalah 3.14 dan nilai indeks reformasi birokrasi adalah 76.33, sehingga target IKU yang sudah ditetapkan tidak tercapai. Penelitian dilakukan untuk mengetahui sejauh mana tingkat kesiapan Kemenkumham dalam mengimplementasikan manajemen pengetahuan dan rekomendasi apa yang perlu diberikan terhadap hasil analisis untuk meningkatkannilaipenyelenggaraanreformasibirokrasidiKemenkumham. Penelitian ini menggunakan metode penelitian kombinasi yang menggabungkan metode kualitatif dan metode kuantitatif. Metode kualitatif digunakan pada saat penyusunan kerangka teoretis dan penyusunan rekomendasi. Metode kuantitatif digunakan untuk mengumpulkan pendapat pegawai Kemenkumham dan melakukan pembobotan faktor dengan menggunakan kuesioner sebagai instrumennya. Pembobotan dilakukan dengan menggunakan analitycal hierarchy process (AHP). Berdasarkan hasil analisis, tingkat kesiapan Kemenkumham berada pada nilai 3.995 yang berarti Kemenkumham siap mengimplementasikan manajemen pengetahuan dengan sedikit peningkatan. Rekomendasi perbaikan diberikan kepada indikator dengan nilai kesiapan di bawah 4.2 atau indikator di bawah tingkat siap untuk mengimplementasikan manajeme n pengetahuan.

ABSTRACT
The Ministry of Law and Human Rights (Kemenkumham) has duties and functions in the fields of human rights, legislation, general law administration, intellectual property rights, correctional and immigration. The 2017 Kemenkumham government agency performance report (LAKIP) states that 2 (two) key performance indicators (IKU) of Kemenkumham, namely the integrity index has a target value of 3.3 and the bureaucratic reform index has a target value of 85. The results of 2017 Kemenkumham bureaucratic reform implementation mention that the integrity index value is 3.14 and the bureaucratic reform index value is 76.33, so the target IKU that has been set is not achieved. The study was conducted to determine the extent of Kemenkumham readiness in implementing knowledge management and what recommendations need to be given to the results of the analysis to increase the value of implementing bureaucratic reform at Kemenkumham. This study uses a combination research method that combines qualitative methods and quantitative methods. Qualitative methods are used when compiling theoretical frameworks and formulating recommendations. The quantitative method is used to collect the opinions of Kemenkumham employees and do factor weighting using a questionnaire as an instrument. Weighting is done using the analitycal hierarchy process (AHP). Based on the results of the analysis, the level of readiness of Kemenkumham is at the value of 3,995 which means that the Ministry of Law and Human Rights is ready to implement knowledge management with a slight increase. Improvement recommendations are given to indicators with readiness values below 4.2 or indicators below the level ready to implement knowledge management."
Depok: Fakultas Ilmu Komputer Universitas Indonesia, 2019
TA-Pdf
UI - Tugas Akhir  Universitas Indonesia Library
cover
Adrian Chandra Rachman
"Sumber daya manusia (SDM) telah menjadi sumber daya yang penting dalam perkembangan perekonomian perusahaan. Sebagai elemen penting, SDM memiliki sistem sendiri yang menunjang pekerjaan yang digunakan di perusahaan, yaitu SISDM. Untuk mengetahui efisiensi dan efektivitas SISDM, maka diperlukan evaluasi. Penelitian ini mengidentifikasi dimensi pengukuran kualitas SISDM dan pengaruhnya terhadap efisiensi dan efektivitas penggunaan SISDM di perusahaan. Model penelitian ini menggunakan framework HOT-Fit Model dengan menerapkan mixed methods, yaitu penelitian kualitatif dengan thematic analysis dan penelitian kuantitatif dengan analisis kuantitatif PLS-SEM. Pada penelitian kualitatif, model penelitian yang dikembangkan terdiri dari 9 variabel penelitian yang diperoleh berdasarkan hasil wawancara dengan narasumber dari PT XYZ dan studi literatur. Pada penelitian ini, sebanyak 13 hipotesis diajukan yang dianalisis menggunakan SmartPLS. Setelah kuesioner dibagikan, terkumpul data bersih sejumlah 41 data. Hasil dari analisis menunjukkan terdapat beberapa hipotesis yang diterima dan ditolak. System quality berpengaruh positif terhadap system use dan user satisfaction. Namun, information quality tidak berpengaruh positif terhadap system use dan user satisfaction. Lebih lanjut, service quality terbukti berhubungan positif dengan user satisfaction, sedangkan service quality terhadap system use tidak berhubungan positif. Hipotesis akhir, ditemukan bahwa system use tidak memiliki pengaruh yang signifikan terhadap HRIS Management Net Benefits, sedangkan user satisfaction memiliki hubungan yang positif yang signifikan terhadap HRIS Management Net Benefits. Penelitian ini diharapkan dapat menjadi acuan dalam mengevaluasi SISDM bagi perusahaan yang menggunakannya.

Human resources (HR) have become an important resource in the development of the company's economy. As an important element, HR has its own system that supports the work used in the company, namely HRIS. To determine the efficiency and effectiveness of HRIS, an evaluation is needed. This study identified the dimensions of HRIS quality measurement and their influence on the efficiency and effectiveness of using HRIS in companies. This research model uses the HOT-Fit Model framework by applying mixed methods, namely qualitative research with thematic analysis and quantitative research with PLS-SEM quantitative analysis. In qualitative research, the research model developed consists of 9 research variables obtained based on the results of interviews with informants from PT XYZ and literature studies. In this study, 13 hypotheses were proposed which were analyzed using SmartPLS. After the questionnaires were distributed, 41 data were collected. The results of the analysis show that there are several hypotheses that are accepted and rejected. System quality has a positive effect on system use and user satisfaction. However, information quality has no positive effect on system use and user satisfaction. Furthermore, service quality is proven to be positively related to user satisfaction, while service quality to system use is not positively related. The final hypothesis is that system use does not have a significant effect on HRIS Management Net Benefits, while user satisfaction has a significant positive relationship with HRIS Management Net Benefits. This research is expected to be a reference in evaluating HRIS for companies that use it."
Depok: Fakultas Ilmu Komputer Universitas Indonesia, 2023
S-pdf
UI - Skripsi Membership  Universitas Indonesia Library
cover
Oktaviana Dwi Amartani
"Industri film Indonesia menghadirkan paradoks antara daya tarik kerja kreatif dan kerentanan struktural tenaga kerja, dimana fleksibilitas dan kebebasan kerap menyamarkan ketidakpastian dan ketimpangan. Narasi yang meromantisasi penderitaan sebagai bagian dari proses kreatif berkontribusi terhadap normalisasi kondisi kerja yang tidak layak. Penelitian ini bertujuan untuk menganalisis kesejahteraan pekerja film Indonesia dan menyoroti urgensi untuk membingkai ulang pengalaman kerja kreatif khususnya pada tahap penciptaan, dengan menggunakan pendekatan metode campuran konvergen. Pendekatan ini menggabungkan analisis regresi logit terhadap 101 responden dan dua subsampel hierarki peran, serta analisis tematik berdasarkan wawancara mendalam terhadap lima informan yang merepresentasikan variasi hierarki peran dalam struktur produksi tahap penciptaan. Analisis berpijak pada tiga kerangka teoritis, yaitu fungsi utilitas dalam model neoklasik, indikator kesejahteraan OECD, dan kerangka PERMA+4. Hasil penelitian menunjukkan konvergensi antara temuan kuantitatif dan kualitatif, sebagian pekerja menunjukkan skor kesejahteraan yang relatif positif meskipun berada dalam kondisi kerja yang rentan. Fenomena ini menunjukkan adanya proses negosiasi nilai personal terhadap tekanan sistemik, serta masih kuatnya romantisasi penderitaan dalam industri film Indonesia. Studi ini merekomendasikan kebijakan ketenagakerjaan yang memerhatikan keseimbangan antara dimensi struktural dan dimensi intrinsik untuk mendukung keberlanjutan karier kreatif yang memerlukan pergeseran retorika fleksibilitas menuju kerangka yang menempatkan martabat pekerja dan kesejahteraan holistik sebagai pusat perhatian.

The Indonesian film industry embodies a paradox of creative charm and labor precarity, where flexibility and freedom coexist with structural vulnerabilities. Romanticized narratives of creative suffering have contributed to the normalization of poor working conditions, highlighting the urgent need to reframe them through a well-being perspective. This study employed a convergent mixed-methods approach, integrating a quantitative logit regression analysis of 101 film workers and two hierarchical subsamples, alongside a qualitative thematic analysis based on in-depth interviews with five informants representing diverse role hierarchies. The analysis was grounded in three theoretical frameworks: the utility function in neoclassical model, the OECD well-being indicators, and the PERMA+4 framework. Findings reveal a convergence between quantitative and qualitative insights. Despite operating within precarious working environments, a portion of film workers exhibited relatively positive well-being scores. This outcome is attributed to individual negotiations of personal values in response to systemic pressures, illustrating the enduring presence of creative suffering romanticization within the film labor culture. The study underscores the need for labor policy reforms that integrate both structural and intrinsic dimensions of well-being. Supporting sustainable creative careers requires a shift beyond flexibility rhetoric toward a framework that centers worker dignity and holistic welfare."
Depok: Fakultas Ekonomi dan Bisnis Universitas Indonesia, 2025
T-pdf
UI - Tesis Membership  Universitas Indonesia Library
<<   1 2   >>